PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0093s0460.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 320aa    MW: 36594 Da    PI: 7.1083
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0093s0460.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.33.6e-54101391128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvka.eekewyfFskrdkkyatgkrknratksgyWk 84 
                             +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi+evd++k+ePwdL+ k ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wk
  SapurV1A.0093s0460.1.p  10 VPPGFRFHPTDEELLYYYLRKKVSYEAIDL-DVIREVDLNKLEPWDLKdKcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWK 95 
                             69****************************.9***************943444443456**************************** PP

                     NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             atg+dk+++ ++++ +g++ktLvfy+grap+g+ktdW+mheyrl
  SapurV1A.0093s0460.1.p  96 ATGRDKAIHLSNSQRIGMRKTLVFYTGRAPHGQKTDWIMHEYRL 139
                             ******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-603159IPR003441NAC domain
PROSITE profilePS5100558.21610159IPR003441NAC domain
PfamPF023653.7E-2811139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MMAGNGQLSV PPGFRFHPTD EELLYYYLRK KVSYEAIDLD VIREVDLNKL EPWDLKDKCR  60
IGSGPQNEWY FFSHKDKKYP TGTRTNRATT AGFWKATGRD KAIHLSNSQR IGMRKTLVFY  120
TGRAPHGQKT DWIMHEYRLD DDNSEVQEDG WVVCRVFKKK SQARGFLPEV YQEEHFSQIK  180
ASASSLPPEP KQNHMQSIYD DYTFDGSMHL PQLFSPESAV APAFVSPLSL NNMDEIECSQ  240
NLLRLTSTGC GLVQPAGRFN GDWSFLDKLL ASQQNLDHQQ HYQNKGNSSS QIVDHVGTST  300
QKFPFQYLGF DSDILRFSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-54716414170NO APICAL MERISTEM PROTEIN
1ut4_B3e-54716414170NO APICAL MERISTEM PROTEIN
1ut7_A3e-54716414170NO APICAL MERISTEM PROTEIN
1ut7_B3e-54716414170NO APICAL MERISTEM PROTEIN
3swm_A3e-54716417173NAC domain-containing protein 19
3swm_B3e-54716417173NAC domain-containing protein 19
3swm_C3e-54716417173NAC domain-containing protein 19
3swm_D3e-54716417173NAC domain-containing protein 19
3swp_A3e-54716417173NAC domain-containing protein 19
3swp_B3e-54716417173NAC domain-containing protein 19
3swp_C3e-54716417173NAC domain-containing protein 19
3swp_D3e-54716417173NAC domain-containing protein 19
4dul_A3e-54716414170NAC domain-containing protein 19
4dul_B3e-54716414170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316163.20.0no apical meristem family protein
RefseqXP_011014561.10.0PREDICTED: protein SOMBRERO-like
RefseqXP_011014569.10.0PREDICTED: protein SOMBRERO-like
SwissprotQ9MA171e-127SMB_ARATH; Protein SOMBRERO
TrEMBLB9HYE40.0B9HYE4_POPTR; No apical meristem family protein
STRINGPOPTR_0010s18420.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72043447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-118NAC family protein